stevenrombauts / genes-component
Package info
github.com/stevenrombauts/genes-component
Type:nooku-component
pkg:composer/stevenrombauts/genes-component
Requires
This package is auto-updated.
Last update: 2026-03-22 15:23:30 UTC
README
The Genes component is a reusable component for Nooku Framework. This is an example!
By installing this component you can easily re-use the functionality its classes offer in your own components.
Installing
You can install this extension using Composer. Add the following requirements to your composer.json file in your Joomla application's root directory:
{
"require": {
"stevenrombauts/genes-component": "dev-master"
},
"minimum-stability": "dev"
}
Run composer install to take care of downloading and installing the package.
Examples
Gene entity
Having your entities extend the ComGenesModelEntityGene class will automatically add support for translating the DNA sequence into a protein sequence. Or call it directly:
$sequence = <<<EOL > A sequence ATGCAGACTGACGATTCTTGGAAACATAATGTGTCGTTTTATACA AATTTGGACTACACCGATAAGGATACCAAAATCAGTGCAGTTTAA EOL; $data = array( 'identifier' => 'C02H7.2', 'title' => 'npr-19', 'sequence' => $sequence ); $entity = KOBjectManager::getInstance()->getObject('com://stevenrombauts/genes.model.entity.gene', array('data' => $data)); echo $entity->protein;
Fasta filter
You can use the FASTA filter to validate and sanitize strings representings nucleotide sequences or peptide sequences.
Example:
$filter = KObjectManager::getInstance()->getObject('com://stevenrombauts/genes.filter.fasta'); $sequence = <<<EOL > LCBO - Prolactin precursor - Bovine ; a sample sequence in FASTA format MDSKGSSQKGSRLLLLLVVSNLLLCQGVVSTPVCPN EMFNEFDQVIPGAKETEPYPVWSGLPSLQTKDED ARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC* EOL; // This one should be valid: echo ($filter->validate($sequence) === true ? "Valid sequence" : "Invalid sequence"); // Sanitizing will remove all characters that don't belong (line-breaks, comments, etc ..): echo $filter->sanitize($sequence);